SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011032547.1.82674 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011032547.1.82674
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.4e-22
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00026
Further Details:      
 
Domain Number 2 Region: 81-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.58e-20
Family Cold shock DNA-binding domain-like 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011032547.1.82674
Sequence length 194
Comment MULTISPECIES: DNA-directed RNA polymerase [Methanosarcina]; AA=GCF_000970225.1; RF=na; TAX=1434114; STAX=2209; NAME=Methanosarcina mazei LYC; strain=LYC; AL=Complete Genome; RT=Major
Sequence
MYKLMKLVDTVRIPPTLLGEEIMPTIKNALREKLEGQVDKKLGSLVAVYNIDEVGEGHIL
VGDGAVYYDVTFEAIMFYPDLQEIIEGEVVEAVGFGVFIGMGPMDGLLHVSQITDDFISY
DAKNARLVTKSGGKSIAEGDHVRARIVAVSINEREPKESKIGLTMRQTALGKLQWLEEAR
RKKQPQETPGEEAA
Download sequence
Identical sequences A0A0E3LVM0 Q8PZ98
WP_011032547.1.13782 WP_011032547.1.23878 WP_011032547.1.49674 WP_011032547.1.82674 WP_011032547.1.90340 192952.MM_0596 gi|21226698|ref|NP_632620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]