SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011210519.1.78782 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011210519.1.78782
Domain Number - Region: 150-172
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0745
Family Cysteine-rich DNA binding domain, (DM domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011210519.1.78782
Sequence length 271
Comment hypothetical protein [Nocardia farcinica]; AA=GCF_000009805.1; RF=na; TAX=247156; STAX=37329; NAME=Nocardia farcinica IFM 10152; strain=IFM 10152; AL=Complete Genome; RT=Major
Sequence
MSREVRRVPLDFNWPLNKVWSGYLTPEKFHETRCQDCYGRGSTPARQWVERIGLMLDQLI
RDLDDQAGGKAMHPWLANDPYPPVNRDNVLSRRGWMVEYEVVRPSADIVEFAQELVKDDE
YERNRTIKRGPFAQNQYAITNGLLRRAGMPEKWGWCATCNGHGSVEAYEGQRAEAEAWEP
TEPPEGDGWQLWETVSEGSPITPVFATREGLVDHLCSPAYRRPLTRDEAEGLVDAGWVPS
GIGNSLGFVAGEQSQGKFAAVVLGLTERGDA
Download sequence
Identical sequences Q5YSK7
247156.nfa39860 WP_011210519.1.78782 gi|54025956|ref|YP_120198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]