SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011262411.1.102040 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011262411.1.102040
Domain Number - Region: 6-45
Classification Level Classification E-value
Superfamily HR1 repeat 0.0418
Family HR1 repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011262411.1.102040
Sequence length 58
Comment hypothetical protein [Aliivibrio fischeri]; AA=GCF_001640445.1; RF=na; TAX=668; STAX=668; NAME=Aliivibrio fischeri; strain=MB13B2; AL=Contig; RT=Major
Sequence
MITCKSKLEAAFKQALEAHHHEQKQLTVAAQELGSCNKTIDCLSLEEIIYLKLVMSLP
Download sequence
Identical sequences A0A1B9P515 B1WN46 B5FGZ0
WP_011262411.1.100783 WP_011262411.1.102040 WP_011262411.1.11820 WP_011262411.1.198 WP_011262411.1.21775 WP_011262411.1.21836 WP_011262411.1.23113 WP_011262411.1.31530 WP_011262411.1.32349 WP_011262411.1.34024 WP_011262411.1.3463 WP_011262411.1.34959 WP_011262411.1.44395 WP_011262411.1.47877 WP_011262411.1.66091 WP_011262411.1.76652 WP_011262411.1.77059 WP_011262411.1.80135 WP_011262411.1.82276 WP_011262411.1.85856 WP_011262411.1.94618 WP_011262411.1.97281 YP_001816710.1.56684 gi|197335017|ref|YP_002156762.1| gi|172087737|ref|YP_001816710.1| 312309.VF_2638 388396.VFMJ11_2068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]