SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011274372.1.14283 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011274372.1.14283
Domain Number 1 Region: 58-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 4.32e-25
Family Ribosomal protein L9 C-domain 0.0000583
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.74e-17
Family Ribosomal protein L9 N-domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011274372.1.14283
Sequence length 148
Comment MULTISPECIES: 50S ribosomal protein L9 [Staphylococcus]; AA=GCF_001234485.1; RF=na; TAX=1283; STAX=1283; NAME=Staphylococcus haemolyticus; strain=CN1234; AL=Scaffold; RT=Major
Sequence
MKVIFTQDVKGKGKKGEIKDVPVGYANNFLIKNNYAVEATPGNLKQLEQQNKRAEADRQK
EIDDAKALKSKLEEIEVEVSAKTGEGGKLFGSVSTKQIAEALKTQHDIKIDKRKMDLPQG
IHALGYTNVPVKLDKEVEGTIRVHTVEK
Download sequence
Identical sequences A0A1J4HM02 A0A2K0AW75 Q4LAK2
gi|70725015|ref|YP_251929.1| WP_011274372.1.100919 WP_011274372.1.101333 WP_011274372.1.1027 WP_011274372.1.12258 WP_011274372.1.13054 WP_011274372.1.14283 WP_011274372.1.19908 WP_011274372.1.20173 WP_011274372.1.20249 WP_011274372.1.20888 WP_011274372.1.22102 WP_011274372.1.35058 WP_011274372.1.37236 WP_011274372.1.41705 WP_011274372.1.46811 WP_011274372.1.48683 WP_011274372.1.57178 WP_011274372.1.58879 WP_011274372.1.60041 WP_011274372.1.66793 WP_011274372.1.67157 WP_011274372.1.67846 WP_011274372.1.67849 WP_011274372.1.68328 WP_011274372.1.7082 WP_011274372.1.74601 WP_011274372.1.75368 WP_011274372.1.76617 WP_011274372.1.76990 WP_011274372.1.76992 WP_011274372.1.79350 WP_011274372.1.8193 WP_011274372.1.82332 WP_011274372.1.82878 WP_011274372.1.84838 WP_011274372.1.87015 WP_011274372.1.8934 WP_011274372.1.90039 WP_011274372.1.91567 WP_011274372.1.92000 WP_011274372.1.98902 279808.SH0014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]