SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011347740.1.772 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011347740.1.772
Domain Number 1 Region: 89-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.01e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011347740.1.772
Sequence length 232
Comment MULTISPECIES: glutathione S-transferase [Xanthomonas]; AA=GCF_001009045.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=376; AL=Scaffold; RT=Major
Sequence
MITVHHLNNSRSQRVLWLLEELALPYQIVRHERDPKTMLAPPALRAIHPLGKSPVLVDGD
LVVAESGAILEYLTERYDTECALSPSPRPLDSPERLQFRYWMHYAEGSAMPPLLMTLIFG
RIRSAPMPFFAKPIARAIVDKAMSGFVGPQLTLHLDWMEQSLQAGNWFAGERFTAADIQM
SFPVQAAAARGGGLEKYPRLHAFLQRIQARPAYQAALKKGGPFELMGSKPAN
Download sequence
Identical sequences G2LVD0 Q3BSE1
WP_011347740.1.100156 WP_011347740.1.10442 WP_011347740.1.11230 WP_011347740.1.13735 WP_011347740.1.199 WP_011347740.1.21303 WP_011347740.1.21317 WP_011347740.1.2230 WP_011347740.1.2259 WP_011347740.1.23534 WP_011347740.1.27112 WP_011347740.1.29361 WP_011347740.1.3003 WP_011347740.1.331 WP_011347740.1.37942 WP_011347740.1.39371 WP_011347740.1.40690 WP_011347740.1.43396 WP_011347740.1.44794 WP_011347740.1.46449 WP_011347740.1.46677 WP_011347740.1.49886 WP_011347740.1.55770 WP_011347740.1.60785 WP_011347740.1.64411 WP_011347740.1.66420 WP_011347740.1.67180 WP_011347740.1.67877 WP_011347740.1.75734 WP_011347740.1.772 WP_011347740.1.79359 WP_011347740.1.81489 WP_011347740.1.8544 WP_011347740.1.89212 WP_011347740.1.89360 WP_011347740.1.94946 WP_011347740.1.99285 316273.XCV2591 gi|346725288|ref|YP_004851957.1| gi|78048147|ref|YP_364322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]