SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011349199.1.100156 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011349199.1.100156
Domain Number 1 Region: 80-201
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.53e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.5e-22
Family Glutathione S-transferase (GST), N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011349199.1.100156
Sequence length 206
Comment glutathione S-transferase [Xanthomonas euvesicatoria]; AA=GCF_000009165.1; RF=na; TAX=316273; STAX=456327; NAME=Xanthomonas campestris pv. vesicatoria str. 85-10; strain=85-10; AL=Complete Genome; RT=Major
Sequence
MLEIYGKPSSINVRKVLWLCDELGLDYTLHAYGSGFASVQTPEFRALNPNALVPVIRAGE
LVLWESNTICRYLAAHSQRDDLLPAAPAARALVEQWMDWQATELNTAWRYAFMATVRGSA
AHTDAQAIAASVEQWNRHMAILDAQLQRGGPFVLGACFTLADIVLGVSTQRWVASPIAHA
ALPAVAAYYAHLQTRAGFQRHGCTAP
Download sequence
Identical sequences Q3BM18
WP_011349199.1.100156 WP_011349199.1.10442 WP_011349199.1.11230 WP_011349199.1.13735 WP_011349199.1.199 WP_011349199.1.21303 WP_011349199.1.21317 WP_011349199.1.2259 WP_011349199.1.23534 WP_011349199.1.27112 WP_011349199.1.29361 WP_011349199.1.3003 WP_011349199.1.331 WP_011349199.1.37942 WP_011349199.1.39371 WP_011349199.1.40690 WP_011349199.1.43396 WP_011349199.1.44794 WP_011349199.1.46449 WP_011349199.1.46677 WP_011349199.1.49886 WP_011349199.1.55770 WP_011349199.1.60785 WP_011349199.1.64411 WP_011349199.1.66420 WP_011349199.1.67180 WP_011349199.1.67877 WP_011349199.1.75734 WP_011349199.1.772 WP_011349199.1.79359 WP_011349199.1.81489 WP_011349199.1.8544 WP_011349199.1.89212 WP_011349199.1.89360 WP_011349199.1.94946 WP_011349199.1.99285 gi|78050020|ref|YP_366195.1| 316273.XCV4464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]