SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011408292.1.41276 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011408292.1.41276
Domain Number - Region: 38-51
Classification Level Classification E-value
Superfamily Plexin repeat 0.0942
Family Plexin repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011408292.1.41276
Sequence length 260
Comment membrane protein [Xanthomonas oryzae]; AA=GCF_001928495.1; RF=na; TAX=64187; STAX=347; NAME=Xanthomonas oryzae pv. oryzae; strain=DXO-226; AL=Contig; RT=Major
Sequence
MNAWPLLHVGVFASVVMVIGWRWQRRSGNAGPVDVLWAGCLALAAPYCAWMSEGAVLPRV
LVAVLGGVWGARLALHLGVRVFGDPHEDGRYRALRAHWNGSQRKFLGFFLAQAMVVVLFA
VPFLAAASNPRTGWSVWTSIAIAVWLIAVGGEALADRQLSAHKANPANGGKTCRTGLWRY
SRHPNYFFEFVHWFAYLALAVGAGPWPVALCALGPVVMFVFLYRFTGIPYTEQQALRSRG
EDYARYQRSTSAFFPLPPSS
Download sequence
Identical sequences A0A2K1ILG5
gi|84623467|ref|YP_450839.1| WP_011408292.1.12284 WP_011408292.1.20356 WP_011408292.1.22155 WP_011408292.1.22948 WP_011408292.1.2575 WP_011408292.1.28412 WP_011408292.1.39578 WP_011408292.1.41276 WP_011408292.1.49377 WP_011408292.1.56997 WP_011408292.1.57652 WP_011408292.1.57864 WP_011408292.1.63306 WP_011408292.1.71791 WP_011408292.1.73657 WP_011408292.1.87238 WP_011408292.1.91866 342109.XOO_1810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]