SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011499936.1.71292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011499936.1.71292
Domain Number - Region: 54-94
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0484
Family Dimerization motif of sir4 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011499936.1.71292
Sequence length 107
Comment hypothetical protein [Methanococcoides burtonii]; AA=GCF_000013725.1; RF=representative genome; TAX=259564; STAX=29291; NAME=Methanococcoides burtonii DSM 6242; strain=DSM 6242; AL=Complete Genome; RT=Major
Sequence
MDPRDIVFSIVMVVSSFVLTYEWLGRFKYSSANSLIILSAIVMVGALAAMILSVDIRLRR
IEKTLDEKERSLRINVQSIESSMDKKMNEVISVVDEAMDVFNRRSYR
Download sequence
Identical sequences Q12UT3
WP_011499936.1.71292 259564.Mbur_1911 gi|91773851|ref|YP_566543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]