SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011518686.1.12480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011518686.1.12480
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.56e-51
Family DsbA-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011518686.1.12480
Sequence length 197
Comment 2-hydroxychromene-2-carboxylate isomerase [Cupriavidus metallidurans]; AA=GCF_000196015.1; RF=representative genome; TAX=266264; STAX=119219; NAME=Cupriavidus metallidurans CH34; strain=CH34; AL=Complete Genome; RT=Major
Sequence
MNKQVEFFFDFGSPYSYLAYKELPRVAARTGATIMWRPMLLGGVFKATGNHSPAEIPAKS
KWSSGDTERWARRYDAPFRHNPFFPVNTLALMRGAIGYQRKGDAEFHRYVDAIFSAMWEH
GKNLNDPNEIGKVLVAAGFDPREALAMLDDPEVKAELKQVTEEAVARGIFGAPSFIVDGE
LFWGNDRLTFVEEQLAG
Download sequence
Identical sequences Q1LFL3
WP_011518686.1.12480 WP_011518686.1.25839 gi|94313123|ref|YP_586332.1| 266264.Rmet_4196 gi|94313123|ref|YP_586332.1|NC_007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]