SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011586645.1.19587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011586645.1.19587
Domain Number - Region: 58-119
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0671
Family p53 DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011586645.1.19587
Sequence length 156
Comment hypothetical protein [Cytophaga hutchinsonii]; AA=GCF_900119565.1; RF=na; TAX=269798; STAX=985; NAME=Cytophaga hutchinsonii ATCC 33406; strain=DSM 1761; AL=Scaffold; RT=Major
Sequence
MKTKCILTLFLVVSLTTLTFATDSTSIYGSWKLQSYHIYTNSKGMDTTYFTTGHIDFNSN
HTYSTNHLQMCFMEGNNFYCPPNTQGDWDFTSKNVLKLTYADRQLICDGQCPDIMSRHGV
YVKALNKGTMILRTEYYNGPRKHRLVIDAYLVRKIE
Download sequence
Identical sequences Q11PX6
2005297349 WP_011586645.1.19587 WP_011586645.1.79486 gi|110639670|ref|YP_679880.1| 269798.CHU_3298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]