SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011638679.1.15765 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011638679.1.15765
Domain Number - Region: 2-33
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.034
Family Trimerization domain of TRAF 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011638679.1.15765
Sequence length 70
Comment protein SlyX [Shewanella frigidimarina]; AA=GCF_000014705.1; RF=representative genome; TAX=318167; STAX=56812; NAME=Shewanella frigidimarina NCIMB 400; strain=NCIMB 400; AL=Complete Genome; RT=Major
Sequence
MESVLQKIDDLEMKLSFQDISIEELNQEVIKLNALVARQQQQMLLMVNKLHSIEPSNMAS
SAEETPPPHY
Download sequence
Identical sequences A0A106BYE0 A0A2I0HBV2 Q07Y38
WP_011638679.1.15765 WP_011638679.1.45693 gi|114564401|ref|YP_751915.1| 318167.Sfri_3240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]