SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011833670.1.86236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011833670.1.86236
Domain Number 1 Region: 170-252
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.35e-21
Family eIF-2-alpha, C-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 83-169
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 2.94e-20
Family eIF2alpha middle domain-like 0.0058
Further Details:      
 
Domain Number 3 Region: 9-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.72e-17
Family Cold shock DNA-binding domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011833670.1.86236
Sequence length 257
Comment translation initiation factor IF-2 subunit alpha [Methanocorpusculum labreanum]; AA=GCF_000015765.1; RF=representative genome; TAX=410358; STAX=83984; NAME=Methanocorpusculum labreanum Z; strain=Z; AL=Complete Genome; RT=Major
Sequence
MSERDWPIEGELVVCSVTEVKDFAAFVNLDEYEGRQGLIPIAEIARGWIKYIRDYIREGQ
KVVCKVLHVDEHRGHIDLSLKDVNEHQRREKIQDWKNEQKAHKWIGFASAESKVDVKTFE
EAMYAEFGSLYAAFEGIALYGDATLAKFSLPAEAAAALAKVASENVKVPKVTVSAILELT
STKPDGVNIIRRALRSAEPKVDGAEIELLYLGAPHYRVKVVAPDYKTAEKALVKASEAAI
GVMERAEGSGKLIRKQK
Download sequence
Identical sequences A2ST11
410358.Mlab_1299 gi|124486118|ref|YP_001030734.1| WP_011833670.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]