SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012022166.1.99084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012022166.1.99084
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.14e-20
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00034
Further Details:      
 
Domain Number 2 Region: 82-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-18
Family Cold shock DNA-binding domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012022166.1.99084
Sequence length 176
Comment DNA-directed RNA polymerase [Metallosphaera sedula]; AA=GCF_000747605.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=CuR1; AL=Chromosome; RT=Major
Sequence
MFKVVKARGVVRIPPELFGEPLNKTAIEILNNEYKERLFKDLGLVLSVIRADVNEEGMII
FGDGATYHEVEFELLTFSPMIQEVIEGDITQVDNYGIYVNMGPMDGLVHVSQIGDDNYKF
DSVRGILIGEKSKKTFQKGDMVRARIMTISSTASNRLPRIGLTMRQMGLGKVERRN
Download sequence
Identical sequences A0A088E9H4 A4YIX7
WP_012022166.1.15515 WP_012022166.1.27320 WP_012022166.1.28583 WP_012022166.1.31166 WP_012022166.1.34633 WP_012022166.1.8883 WP_012022166.1.99084 399549.Msed_2241 gi|146304987|ref|YP_001192303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]