SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012022191.1.99084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012022191.1.99084
Domain Number 1 Region: 34-122
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 5.23e-17
Family tRNA-intron endonuclease catalytic domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012022191.1.99084
Sequence length 124
Comment hypothetical protein [Metallosphaera sedula]; AA=GCF_000747605.1; RF=na; TAX=43687; STAX=43687; NAME=Metallosphaera sedula; strain=CuR1; AL=Chromosome; RT=Major
Sequence
MSNAFEELMDFLSKGDIEEAITRARLLEKNDKSAWNKFVVYLDLRTKGKKVSISNIGPSL
GILDRNNKLVALVLVISENESIDMEKIIDLVKFAKSMRMEIFMALVDKYGDITYYTLEEI
NLTK
Download sequence
Identical sequences A0A088E9K0 A4YJ02
WP_012022191.1.15515 WP_012022191.1.27320 WP_012022191.1.28583 WP_012022191.1.31166 WP_012022191.1.34633 WP_012022191.1.8883 WP_012022191.1.99084 399549.Msed_2266 gi|146305012|ref|YP_001192328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]