SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012068260.1.31125 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012068260.1.31125
Domain Number - Region: 5-75
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0114
Family CAP C-terminal domain-like 0.066
Further Details:      
 
Domain Number - Region: 76-169
Classification Level Classification E-value
Superfamily Bromodomain 0.0785
Family Bromodomain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012068260.1.31125
Sequence length 178
Comment MarR family transcriptional regulator [Methanococcus maripaludis]; AA=GCF_000017225.1; RF=representative genome; TAX=426368; STAX=39152; NAME=Methanococcus maripaludis C7; strain=C7; AL=Complete Genome; RT=Major
Sequence
MVSQDDILYEFYNNDGILTTDELKDLSGIPKEESIRSISKSMNSLIQKKLIGKVKGPKNS
TIYFLTNPYYFLCDDKERLKHEKTHCLNVIKKVMEHHDECRIFEQQDMLILKFNATYQIR
NHLKLIKSIIELFGNCLKYVLHDNYIIVTGKTHLEIDMFNINHFLREEKEMNFKKNIK
Download sequence
Identical sequences A6VK24
426368.MmarC7_1744 WP_012068260.1.31125 gi|150403657|ref|YP_001330951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]