SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012075855.1.6249 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012075855.1.6249
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.45e-62
Family PA2201 N-terminal domain-like 0.00000166
Further Details:      
 
Domain Number 2 Region: 138-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.7e-41
Family PA2201 C-terminal domain-like 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012075855.1.6249
Sequence length 294
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_001450165.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=WH-SGI-V-07370; AL=Contig; RT=Major
Sequence
MYAPTPALDNQLADALPQWRDLARTAAVPRRNLDLADWNADWRGLFGALERFSRSHAYRQ
PGAVQGYAALESAWSWGSAAENASTLLLKGIDRGLPGAVLRPVYRETAALWLDYARLLGA
ARDSLRQQGEENFEATPALAPRSGQYPFALQLLAMGVLLDAQDLLPALVEEVLLFDTDRL
LDYLSAAALGLVEASGETFHPRPFGELRAFFEAPDDSAAQALVPYLQREYREFFQLSPKA
QKKTRRLAGPESWGWWAMEVSALSVLYGWDDKALRDSPHYLADLVDYARAQGSD
Download sequence
Identical sequences A0A0V2QW90 A6V5X1
381754.PSPA7_3095 WP_012075855.1.56850 WP_012075855.1.6249 WP_012075855.1.84917 WP_012075855.1.90922 gi|152986093|ref|YP_001348456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]