SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012097141.1.20576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012097141.1.20576
Domain Number 1 Region: 222-404
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-35
Family Histidine kinase 0.00094
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily CheY-like 4.98e-23
Family CheY-related 0.0035
Further Details:      
 
Domain Number 3 Region: 153-233
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000192
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012097141.1.20576
Sequence length 418
Comment hybrid sensor histidine kinase/response regulator [Anaeromyxobacter sp. Fw109-5]; AA=GCF_000017505.1; RF=na; TAX=404589; STAX=404589; NAME=Anaeromyxobacter sp. Fw109-5; strain=Fw109-5; AL=Complete Genome; RT=Major
Sequence
MPRRVLCIEGDAEVRARVKTRLEREGFTVDTSASGLEGIERALTSRPDLIVADVHLPDLE
GFELTARLKREKALEHVPIVAVGESRDEHDDAIAAGADGFVDRAADDGQLGAELLEYMDG
KRERLTEQGERERLRTLSGTMAAHLEAALTGARRANARLLELDELKSAFMHNLAHELSTP
LTPLAGYLRILSSEKLGPMSPQQKRIVDSMIHSVTRLARVVDNLSDFASLQAGESPIMEG
AVNPDQLADEVVAEQRPMIRDARLHVVVAHAGGEPVIADPRKLRQAIANIVSNAVKFSPH
GGEVLVEVTRQPGKLRYTVYDQGPGIRSLEQERIFEPLHHARARGTDEARLPGSGLGLPV
ARRIAEAHGGRVWVESPPRTQPGSLARQFTGSKFVLEIPVRPADQPTAGKAPSAASLA
Download sequence
Identical sequences A7HCV8
WP_012097141.1.20576 404589.Anae109_2352 gi|153005213|ref|YP_001379538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]