SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012112491.1.7923 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012112491.1.7923
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.64e-52
Family Ribonuclease PH domain 1-like 0.0000132
Further Details:      
 
Domain Number 2 Region: 296-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-46
Family Ribonuclease PH domain 1-like 0.0000171
Further Details:      
 
Domain Number 3 Region: 145-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.1e-27
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.32e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.07e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 621-702
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.22e-21
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 
Domain Number 7 Region: 238-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.23e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012112491.1.7923
Sequence length 728
Comment polyribonucleotide nucleotidyltransferase [Parvibaculum lavamentivorans]; AA=GCF_000017565.1; RF=representative genome; TAX=402881; STAX=256618; NAME=Parvibaculum lavamentivorans DS-1; strain=DS-1; AL=Complete Genome; RT=Major
Sequence
MFKITREEIEWGGRTLVLETGKIARQADGAVLATYGDTTVLATVVGERKPKPGLDFFPLT
VNYQEKTYAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFIKGFKNETQVIATVVSH
DMENDPDIVAMIAVSAALTISGLPFLGPIGAARVGYIGGEYKLNPMIDEMPESALDLVVA
GTADAVMMVESEAKELSEDIMLGAVMFGHKEFQPVIDMIIRMAEKCAKEPRAIDVKDNSE
LVAKVRELAESDVRAAYGLKDKGQRHEALAAAKDKVKSALCNPEDPNAVSETDVGGVFKS
IESDVVRNSILDTKSRIDGRDLETVRPIVSEVGVLPRTHGSALFTRGETQALVVATLGTG
DDEQFIDALEGTYKENFLLHYNFPPFSVGETGRVGFTGRREVGHGKLAWRALRAVLPPKT
EFPYTLRLVSEITESNGSSSMATVCGSSLAMMDAGVPLKRAVAGIAMGLILEGERFAVLS
DILGDEDHLGDMDFKVAGTQEGVTSLQMDIKITGINERIMKQALAQAKGGRLHILGEMAK
ALDTARPEMGEYAPRIEVITVPTDKIREVIGTGGKVIREIVEKTGAKVDISDDGTIKVAS
SDGESIRKAIAWIQGIVAEPEVGKIYEGTVVKAVDFGAFVNFFGPRDGLVHISQMAPTRV
EQVSDVVKEGDKVKVKLLGFDDRGKVRLSMKHVNQETGEEIVYENEPAEQPREKREGGGG
RGRRRERD
Download sequence
Identical sequences A7HZ97
402881.Plav_3632 WP_012112491.1.7923 gi|154254063|ref|YP_001414887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]