SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012151409.1.81845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012151409.1.81845
Domain Number 1 Region: 222-473
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.76e-85
Family Hsp90 middle domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 3-212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-65
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000725
Further Details:      
 
Domain Number 3 Region: 503-616
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 9.42e-29
Family HSP90 C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012151409.1.81845
Sequence length 621
Comment molecular chaperone HtpG [Rickettsia rickettsii]; AA=GCF_000283815.1; RF=na; TAX=1105100; STAX=783; NAME=Rickettsia rickettsii str. Hino; strain=Hino; AL=Complete Genome; RT=Major
Sequence
MIQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKLRYLSQSNSELVAGDS
NFKITVKVDKDNGQIIIRDNGIGMNKDDLIENLGTIARSGTANFLKSLSGDSKKDNMLIG
QFGVGFYSSFMVADKVTVTSRKAGEDKVHIWESDGLGEYTVSDSDKEFTRGTEIILHIKK
EEDTFLDHFRLKHIVKSYSDHIAVPIYFFDEAGNNEIQLNSASALWTRPKSEITEEQYKE
FYKSLSYAIDDPWITMHNKNEGAIEFTNLLFIPSSKTFDLFHPDRKRRVKLYIKRVFISD
ENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNSVLEKIKNAITKRVLGELRKKKEESP
EEYNKFWANFGGALKEGLCEATTNHEKLLEVCIFRSALHNKMISLDEYIANFKEGQSTIY
YLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVE
QTTSQSEAKNTDSKKSDDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDI
RMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDLKANNKNNEELVNLIFDQACILEGE
PVADTGAFSKRLNDIVQKAIL
Download sequence
Identical sequences A8GTZ5 B0BVI6
gi|379018429|ref|YP_005294664.1| gi|378724644|ref|YP_005289528.1| gi|165933863|ref|YP_001650652.1| gi|157829136|ref|YP_001495378.1| gi|378721946|ref|YP_005286833.1| gi|379017139|ref|YP_005293374.1| WP_012151409.1.17801 WP_012151409.1.31136 WP_012151409.1.38731 WP_012151409.1.4490 WP_012151409.1.74071 WP_012151409.1.77680 WP_012151409.1.78650 WP_012151409.1.81845 WP_012151409.1.83836 WP_012151409.1.89241 392021.A1G_07145 452659.RrIowa_1527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]