SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012157318.1.79101 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012157318.1.79101
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.0314
Family ISP transmembrane anchor 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012157318.1.79101
Sequence length 65
Comment formate dehydrogenase region TAT target [Shewanella pealeana]; AA=GCF_000018285.1; RF=representative genome; TAX=398579; STAX=70864; NAME=Shewanella pealeana ATCC 700345; strain=ATCC 700345; AL=Complete Genome; RT=Major
Sequence
MNKQQPDLNRRSLLKALTIGGTASVAIAATGVSVAQASETKVSTKNENGYHETAHIRSYY
NSLRG
Download sequence
Identical sequences A8HA53
398579.Spea_4130 gi|157963941|ref|YP_001503975.1| WP_012157318.1.79101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]