SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012332697.1.41957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012332697.1.41957
Domain Number - Region: 141-166
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0785
Family Tachycitin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012332697.1.41957
Sequence length 172
Comment hypothetical protein [Methylobacterium sp. 4-46]; AA=GCF_000019365.1; RF=na; TAX=426117; STAX=426117; NAME=Methylobacterium sp. 4-46; strain=4-46; AL=Complete Genome; RT=Major
Sequence
MKRLVIVSAAIASALVLSGTGADARSFGGGFHGGGFHGGGFHGGGFRGGFGGAGFRGGGV
GAGRFGPVGGYRGVAIGGFRGPYGGVGRFGYGRVGWGPGFGYRYGRWYPGYGYRYGAYRR
WYPGWGYGLAGLGLAAGYALSGFPYYGGCGPYAYFDAYYGVCRPIGSWGWAY
Download sequence
Identical sequences B0UID4
426117.M446_2874 gi|170741075|ref|YP_001769730.1| WP_012332697.1.41957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]