SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012552656.1.76155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012552656.1.76155
Domain Number - Region: 5-32
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0241
Family Tachycitin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012552656.1.76155
Sequence length 62
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002146925.1; RF=na; TAX=180855; STAX=1428; NAME=Bacillus thuringiensis serovar canadensis; strain=BGSC 4H2; AL=Contig; RT=Major
Sequence
MLKIGDKVVMHTCGEAQHYDGKVWTCTTDEFVRGKGVYTQNLVFLEGFSGCFLAKYLQKV
IL
Download sequence
Identical sequences A0A0K0SHH0
WP_012552656.1.72484 WP_012552656.1.76155 WP_012552656.1.91615 gi|208701964|ref|YP_002267224.1|NC_011337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]