SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012604777.1.5329 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012604777.1.5329
Domain Number - Region: 19-79
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.00405
Family Adenylylcyclase toxin (the edema factor) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012604777.1.5329
Sequence length 93
Comment MULTISPECIES: cell division protein FtsB [Vibrio]; AA=GCF_000272365.2; RF=na; TAX=1191324; STAX=212663; NAME=Vibrio tasmaniensis 1F-267; strain=1F-267; AL=Scaffold; RT=Major
Sequence
MRIFALVLLIVFGWLQHTLWLGKNGISDYYGVNNEIQVQQQVNEKLHLRNAEMFAEIDDL
RQGLDAIEERARHELGMVKEGETFFRIIGEESH
Download sequence
Identical sequences A0A1C3IGE1 A0A1E5EAA4 A0A1E5EKL4 A0A1W6VB85 B7VK67
WP_012604777.1.30411 WP_012604777.1.40033 WP_012604777.1.409 WP_012604777.1.5329 WP_012604777.1.89696 575788.VS_2606 gi|218710557|ref|YP_002418178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]