SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012660800.1.78799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012660800.1.78799
Domain Number - Region: 105-140
Classification Level Classification E-value
Superfamily Bromodomain 0.00563
Family Bromodomain 0.014
Further Details:      
 
Domain Number - Region: 49-176
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0231
Family Pentapeptide repeats 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012660800.1.78799
Sequence length 204
Comment hypothetical protein [Campylobacter lari]; AA=GCF_000019205.1; RF=representative genome; TAX=306263; STAX=201; NAME=Campylobacter lari RM2100; strain=RM2100; ATCC BAA-1060D; AL=Complete Genome; RT=Major
Sequence
MYKVKNKNELMKLVQNERISLRDIDVSLIEDFSFVFYCSIRKDFLGIERWDVSKAKDMSY
MFYCCESFNADLSRWDVSNVENMASMFFNCKNFNKDLSRWNTQNLKDMSYMFFNCVKFNH
SLLRWKTSNVIRMAHCFENCHAYEHNVASWDVQNVITMAYLFHNCKNFHHELDEWNIQRD
CNTDKMFGNRGIDKLYAVKGVELK
Download sequence
Identical sequences B9KEC9
gi|222823092|ref|YP_002574665.1| 306263.Cla_0047 WP_012660800.1.78799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]