SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012711826.1.91160 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012711826.1.91160
Domain Number 1 Region: 50-138
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 5.49e-16
Family tRNA-intron endonuclease catalytic domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012711826.1.91160
Sequence length 140
Comment tRNA-splicing endonuclease [Sulfolobus islandicus]; AA=GCF_000364745.1; RF=na; TAX=1241935; STAX=43080; NAME=Sulfolobus islandicus LAL14/1; strain=LAL14/1; AL=Complete Genome; RT=Major
Sequence
MKTITFMGNILIFDNVTIMSEKAETTLEKIYLALSSSKQLPSEIIYLVNWDKVDVFVDLK
QRGRVTIDGIDEQSLIIKDKENGKYTAMVLIVDENEKVSFKKILDKLHQSKSMNLELYLS
IVDKYGDVTYYTISEIKMSK
Download sequence
Identical sequences C3MRE3 C3MY39 C3MZH8 C3N7K0 C4KIQ8 D2PDG4 F0NIJ5 F0NRJ5
gi|229579717|ref|YP_002838116.1| gi|238620314|ref|YP_002915140.1| gi|284998336|ref|YP_003420104.1| gi|385776428|ref|YP_005648996.1| gi|227828114|ref|YP_002829894.1| 426118.M164_1869 427317.M1425_1852 427318.M1627_1939 429572.LS215_1961 439386.YG5714_1938 WP_012711826.1.100559 WP_012711826.1.13477 WP_012711826.1.27011 WP_012711826.1.27461 WP_012711826.1.34992 WP_012711826.1.44962 WP_012711826.1.47130 WP_012711826.1.48461 WP_012711826.1.60638 WP_012711826.1.66823 WP_012711826.1.67233 WP_012711826.1.68242 WP_012711826.1.83431 WP_012711826.1.84481 WP_012711826.1.89621 WP_012711826.1.90709 WP_012711826.1.91160 WP_012711826.1.97021 gi|385773793|ref|YP_005646360.1| gi|227830821|ref|YP_002832601.1| gi|229585353|ref|YP_002843855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]