SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012712027.1.68242 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012712027.1.68242
Domain Number - Region: 24-47
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0196
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012712027.1.68242
Sequence length 146
Comment hypothetical protein [Sulfolobus islandicus]; AA=GCF_000022405.1; RF=na; TAX=427317; STAX=43080; NAME=Sulfolobus islandicus M.14.25; strain=M.14.25; AL=Complete Genome; RT=Major
Sequence
MTRNKAKSLLINSVRRVKISLFYLESGLIDEARKEIQKSWREVISALLILNLYSIVEDNK
DREIIHYSVPRSKIFSISKSLEDRGYKDLVKISSMYFSSLQELPKSEIKVLISALADEEI
MHIKEWFSEIWDEKLDEMLNEVKIRR
Download sequence
Identical sequences C3MJQ9 C3MZ17 C3N066 C4KJA5 D2PES2 F0NIR4 F0NL15 M9U8K5
gi|385773999|ref|YP_005646566.1| gi|227831077|ref|YP_002832857.1| gi|227828319|ref|YP_002830099.1| WP_012712027.1.100559 WP_012712027.1.27011 WP_012712027.1.27461 WP_012712027.1.34992 WP_012712027.1.44962 WP_012712027.1.47130 WP_012712027.1.48461 WP_012712027.1.60638 WP_012712027.1.66823 WP_012712027.1.67233 WP_012712027.1.68242 WP_012712027.1.74483 WP_012712027.1.83431 WP_012712027.1.84481 WP_012712027.1.89621 WP_012712027.1.90709 WP_012712027.1.91160 WP_012712027.1.97021 gi|479326309|ref|YP_007866364.1| gi|385776641|ref|YP_005649209.1| gi|238620511|ref|YP_002915337.1| gi|284998573|ref|YP_003420341.1| 426118.M164_2067 427317.M1425_2060 427318.M1627_2140 429572.LS215_2225 gi|229585549|ref|YP_002844051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]