SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012742205.1.32465 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012742205.1.32465
Domain Number - Region: 93-138
Classification Level Classification E-value
Superfamily TIMP-like 0.0589
Family Tissue inhibitor of metalloproteinases, TIMP 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012742205.1.32465
Sequence length 260
Comment hypothetical protein [[Eubacterium] rectale]; AA=GCF_000020605.1; RF=representative genome; TAX=515619; STAX=39491; NAME=[Eubacterium rectale] ATCC 33656; strain=ATCC 33656; AL=Complete Genome; RT=Major
Sequence
MKKIGIRILGCMALLSMVGCGRIEGASVQDLSNTKDAIVESETTLAENNNEYSNKNSLFY
SDISSYEIFTDVNSEAALKNLYYNIDEFIDSDSSDVIVKGNIIEIEYVYIDGCSYSVLTV
DVERAYKGEVQETITVYEDGGYTRLSDEKEQIEAHADLSQYTEEEMENLLINHTFMGAEH
SNVGDTVILFLKTNEGSILGDSYRINCSVFGRYTLNKDSYIRPEFIVENDNPEKITTYSN
MDTFEFSVSKSMLEDKLSQQ
Download sequence
Identical sequences A0A173ZXI1 A0A1Q6PIJ7 C4Z889 D4JJF6 D6E0C4 R6T7Q0
515619.EUBREC_1346 gi|238923724|ref|YP_002937240.1| gi|479215181|ref|YP_007842563.1| WP_012742205.1.101161 WP_012742205.1.32465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]