SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012778500.1.94010 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012778500.1.94010
Domain Number 1 Region: 37-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-35
Family Glutathione peroxidase-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012778500.1.94010
Sequence length 201
Comment cytochrome oxidase [Candidatus Liberibacter asiaticus]; AA=GCF_000346595.1; RF=na; TAX=1174529; STAX=34021; NAME=Candidatus Liberibacter asiaticus str. gxpsy; strain=gxpsy; AL=Complete Genome; RT=Major
Sequence
MKALGIILGTILLAVLGSIAYVSFSSKFVDGNRRFNSDVHLVAQDGTDFSLSSLYIKPSI
VFFGFTNCSAVCPTTLSRLDRLLKQVDPTGTLLNAYFITVDPKRDTPEVMKKFVQRFSDR
IIGISGDPIDVMRVAKNFRIYVNNVLAEKSGVEEKYFVDHTTALLLFDTAGSIVGVIPYK
DDSDSAIEKINRLITYGNVVK
Download sequence
Identical sequences C6XHL1
WP_012778500.1.15810 WP_012778500.1.15976 WP_012778500.1.16756 WP_012778500.1.18731 WP_012778500.1.3509 WP_012778500.1.50033 WP_012778500.1.77054 WP_012778500.1.78654 WP_012778500.1.79050 WP_012778500.1.94010 gi|254780281|ref|YP_003064694.1| 537021.CLIBASIA_00830 gi|470204643|ref|YP_007598741.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]