SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012822735.1.70306 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012822735.1.70306
Domain Number - Region: 36-83
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.00759
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012822735.1.70306
Sequence length 93
Comment MULTISPECIES: hypothetical protein [Pectobacterium]; AA=GCF_000632375.1; RF=na; TAX=1458466; STAX=1905730; NAME=Pectobacterium parmentieri CFIA1002; strain=CFIA1002; AL=Scaffold; RT=Major
Sequence
MIDPKKIEQIARQVHESMPKGIRELGDDVEKKVRQVLQAQLTRLDLVNREEFDIQTQVLL
RTREKIARLEQRLTELEAKLSAEEKPATVAEND
Download sequence
Identical sequences A0A0H3I0W1 D0KIL2
gi|261820335|ref|YP_003258441.1| 561231.Pecwa_1017 gi|470153398|ref|YP_006281900.1| WP_012822735.1.14155 WP_012822735.1.36680 WP_012822735.1.70306 WP_012822735.1.77019 WP_012822735.1.78307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]