SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013025488.1.89124 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013025488.1.89124
Domain Number 1 Region: 71-163
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000102
Family Tetratricopeptide repeat (TPR) 0.0093
Further Details:      
 
Weak hits

Sequence:  WP_013025488.1.89124
Domain Number - Region: 42-61
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00732
Family Antifungal peptide scarabaecin 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013025488.1.89124
Sequence length 183
Comment hypothetical protein [Pantoea ananatis]; AA=GCF_000285975.1; RF=na; TAX=553; STAX=553; NAME=Pantoea ananatis; strain=B1-9; AL=Scaffold; RT=Major
Sequence
MKNTASLLRTPGRKLLVPALLFVIHVAPALAAGDDSTNSKIPDCPRGQVYDSKTKQCVSD
KTARLSDEDKTNYAYHLAKKGDYQAALTLLDSLKQPDTAEAWNYRGYATRKLGRTDEGIG
YYQRSLALNPRYAKVREYLGEAWLIKGRPDLAKVQLKTIASLCGTGCEEYRDLQAAINGH
PES
Download sequence
Identical sequences D4GCU9
gi|386079729|ref|YP_005993254.1| WP_013025488.1.22816 WP_013025488.1.25584 WP_013025488.1.7182 WP_013025488.1.89124 gi|291617158|ref|YP_003519900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]