SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013352390.1.33972 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013352390.1.33972
Domain Number - Region: 70-124
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000798
Family Supernatant protein factor (SPF), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013352390.1.33972
Sequence length 140
Comment MULTISPECIES: hypothetical protein [Bacillus subtilis group]; AA=GCF_002173635.1; RF=na; TAX=1390; STAX=1390; NAME=Bacillus amyloliquefaciens; strain=SRCM101267; AL=Complete Genome; RT=Major
Sequence
MKKKIIAGALAFGLIPLMGTADVSAKALPNQDKVMKPAGWSCDAPYIACQPFSGGTGKVS
FNYQGSSPGKIRVFVANDGSKSFKFTIYYPNGNTLLSTTTLNAGKTFIQEFSVNQKGEYL
LKYDSGTGDSVDGFFRSVEI
Download sequence
Identical sequences A0A0A0TV75 A0A1Y0X8F3
WP_013352390.1.1127 WP_013352390.1.1325 WP_013352390.1.33972 WP_013352390.1.54561 WP_013352390.1.65712 WP_013352390.1.70207 WP_013352390.1.70510 WP_013352390.1.80835 gi|384159253|ref|YP_005541326.1| gi|384168299|ref|YP_005549677.1| gi|384164315|ref|YP_005545694.1| gi|308173737|ref|YP_003920442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]