SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013369005.1.91857 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013369005.1.91857
Domain Number 1 Region: 331-494
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.5e-39
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 253-340
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 3 Region: 213-263
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000209
Family HAMP domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013369005.1.91857
Sequence length 498
Comment MULTISPECIES: two-component sensor histidine kinase [Paenibacillus]; AA=GCF_000237325.1; RF=na; TAX=1052684; STAX=1406; NAME=Paenibacillus polymyxa M1; strain=M1; AL=Complete Genome; RT=Major
Sequence
MKAGRKKRRKYVLRSLRSQLLARTLLILALLLVLIGFLQYFLMKDFLYRSRADAMNTQLN
SIPVDLLIKDSQENSGDGIAAPQDDTNRRGNRPGPFLFWPDMSLASIGIDGTFQSLSNEN
GLKPPRLTTQQYQAMQQSKRMRHGYQLITDAQGKEQLVVFRPLGPPDRSSGLLQMGVSTN
SMQEQLINQLRTFILLSLIALAIGLALMLPVLRRTLVPLSRMVEAVKRIDAGNLDERFDA
EQGQYEVDRLAVSFNGMLERLEHSFAAERELQMQMRRFIADASHELRTPLTSIHGFLEVL
LRGAASNPKQLQSALESMYGESKRMNKLVSDLLLLAKLDRTPELKLEDISLDALLLEMKP
QLLMLAGTRKVFFDMTAGVRVLAEGDKIKQVVLNLFHNAVQHTDMEQGVIHVNLSAGKKL
ADIQIRDNGPGMGKEQLERIFERFYRGDESRTRSSGGAGLGLAITKSIVEAHGGSITAES
TLGTGSIFKVTLPLAGTV
Download sequence
Identical sequences E3ECS1
gi|310639848|ref|YP_003944606.1| WP_013369005.1.14980 WP_013369005.1.91857 WP_013369005.1.99789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]