SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013370181.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013370181.1.14980
Domain Number 1 Region: 248-436,494-528
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.1e-34
Family Type II chitinase 0.0079
Further Details:      
 
Weak hits

Sequence:  WP_013370181.1.14980
Domain Number - Region: 117-294
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.000825
Family beta-Lactamase/D-ala carboxypeptidase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013370181.1.14980
Sequence length 541
Comment glycosyl hydrolase [Paenibacillus polymyxa]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MSSKRSRWLTRFTLSATTAITIFTTFTSYLAAPAAASGVAFRDIAHSYAYQSIISLHAKG
ILNGTQPGYFSPKKAVTRAEWVTALDRTLGLEPVQAVVSSYRDVPKQAWYYGWIEAASQL
DIVQGGSSATFQPNSPITRQEAALMIARLIRSSGGSGGTTSSFTDRDEIADWALEGVTTV
NRYGFMKGENNYFRPASSLTREETAVLLERLLTYSAQHARQAASTTSSIRLGWQYDQTVQ
QFENTVLQSNINTLSPRWFFLNETGSISDYTNSSLLTWSKQHQKKIWAMVGNRSNLALTH
QILSSEVLRATTITQLANAVSVHGLDGLVIDFENVDGQDRAYLTLFVQQLKAKLKSQNAV
LALCVSPDYGTDWTAAFDYRKLGAAADYLILMGYDEHWGGSSIPGSVSSLPWLRESVRRF
VQTTDPEKAILALPLFTRNWTLNTSGQSIASSDISLDQQNQLISRISSKPIWNEDIQQYT
VSYKDTQLHKLWLEEGRSFTRKYRLGQDEGFAGFAYWYSGGASSDLWSSVKNADRFIQRG
L
Download sequence
Identical sequences E3EGZ4
gi|310641037|ref|YP_003945795.1| gi|386040124|ref|YP_005959078.1| WP_013370181.1.14980 WP_013370181.1.91857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]