SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013401104.1.10372 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013401104.1.10372
Domain Number 1 Region: 4-158
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.36e-31
Family SMI1/KNR4-like 0.009
Further Details:      
 
Domain Number 2 Region: 203-254
Classification Level Classification E-value
Superfamily ARM repeat 0.0000504
Family HEAT repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013401104.1.10372
Sequence length 262
Comment MULTISPECIES: cell wall assembly protein [Bacillaceae]; AA=GCF_000966225.1; RF=na; TAX=1426; STAX=1426; NAME=Parageobacillus thermoglucosidans; strain=DSM 2542; AL=Contig; RT=Major
Sequence
MTIWANLESDIYKLPPLRESDIKKAENLFNVKLPKSYLDILKIQNGGSIVFNAHPSPKPT
SWSDHSVNVDFIMGIGENNGILETPYYIEEWQMPEGLILISGQGHSWIAFDYRNTVENPP
IVYIDNETEEIFQIADSFESFLENLYVEEREEEIEFGEFDEIEISKESTMRAIYNNDIDG
IITSVDLMSQEVKAEDLKWFSSVLLQLSKHPNDDVRRSVAEATNFLADSLERNTVKKLIE
IFNQDNSEDVRYFANTISNQIS
Download sequence
Identical sequences A0A0F6BNU7 A0A1Y3Q5Z9
gi|312111393|ref|YP_003989709.1| gi|336235820|ref|YP_004588436.1| WP_013401104.1.100411 WP_013401104.1.10372 WP_013401104.1.15103 WP_013401104.1.21702 WP_013401104.1.44525 WP_013401104.1.50686 WP_013401104.1.65251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]