SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013645689.1.76405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013645689.1.76405
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily SRP19 4.97e-26
Family SRP19 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013645689.1.76405
Sequence length 91
Comment signal recognition particle [Methanobacterium lacus]; AA=GCF_000191585.1; RF=representative genome; TAX=877455; STAX=877455; NAME=Methanobacterium lacus; strain=AL-21; AL=Complete Genome; RT=Major
Sequence
MRATIWPVYIDAKKTKHEGRKVSLEHAITAPKLREISRAAKKLGLNPDVEKDKSYSKSWW
ENSGRVTVDKTMPKREILMKVSNIIRGYREK
Download sequence
Identical sequences F0TBZ6
WP_013645689.1.76405 gi|325959844|ref|YP_004291310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]