SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013705714.1.50338 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013705714.1.50338
Domain Number 1 Region: 283-404,741-848
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-19
Family ABC transporter ATPase domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 16-243
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000051
Family PHP domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013705714.1.50338
Sequence length 884
Comment histidinol-phosphatase [Desulfobacca acetoxidans]; AA=GCF_000195295.1; RF=representative genome; TAX=880072; STAX=60893; NAME=Desulfobacca acetoxidans DSM 11109; strain=DSM 11109; AL=Complete Genome; RT=Major
Sequence
MPLDKQAKPFFSHGSRWLRADFHLHTRADREFCYTGEDSYYFSSYIQGLKKTEIRIGVIT
NHNKFDLAEFNSLRQTAKRENIFLLPGVEHSVGDGANGIHTLIVFSDEWLENGQDYINQF
LNVAFQGRTPQEYENANGRSSLSLIDTIKKLEGYQRDFFLVFAHVEERSGLWHELDGGRM
QELGENEFFRRRSLAFQKVRTHDISDRKCRIKVRAWLGEAYPAEVEGSDCKSIDQIGQGG
CCYLKIGSFTFAAVKYALLDHANRLSGELNRHDSSHILSATFDGGVLDGKTIYFSPELNT
LIGIRGSGKSSILEAMRYGLDIPFGEKALDQDYKRFLVDHVLGSGGKVTIQAVDRRGQRY
EVRRICRERPDVYVEGILQPGISIRETILHKPIYFGQKDLSSTGEGFEKDLVEKLVGEKL
TGIRSKIEAQRQKVSDTINQLERLANVAEKKEEYESKKRDAEFRLKFYKDHGVEEKLQKQ
VDFDADSRKCHHVISLVKDYLAGLEEFINRYEDDLKNECIYTSRQNTVFFDAFFVNYKKL
IAGFLQIKEVLADGKKTLSELQEKFKEFEILKDGLKEEFAEIERKLFEEFKGSGAKAIRP
DEFRQLRKTVDQAKQMLEALNKQEDQRIIFNLELLQELATLNNLWLEEYQAVQAELGKVN
RSHSSLKIKAEFKGDKKAFAGFMKDVFGGSRIRQTTFENLAKEFTDFGAIFRELDKAKTI
IGNALVQVFEKYFTENLASLLTWQVPNRFVIKYRDKELKHHSLGQRASALILFILSQQDN
DLIIIDQPEDDLDNQTIYEDVIKLIRTLKPRTQFIFATHNANFPVLGDAEQIISCAYADD
SISITSGSIDCPDMQRKIVDIMEGGEEAFKQRKRIYEIWKPRSS
Download sequence
Identical sequences F2NGI8
gi|328952448|ref|YP_004369782.1| WP_013705714.1.50338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]