SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013734497.1.63642 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013734497.1.63642
Domain Number - Region: 11-54
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0338
Family Gelsolin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013734497.1.63642
Sequence length 86
Comment hypothetical protein [Verrucosispora maris]; AA=GCF_001507315.1; RF=na; TAX=1003110; STAX=1003110; NAME=Verrucosispora maris; strain=NRRL B-24793; AL=Contig; RT=Major
Sequence
MDRMVAWEYALLVRRYQGQGRNFHVTFVWYGPDGSRKDVTAYGDTAVAHLNRVGREGWEL
VTAAEDVNNVQGSTEVHRYHLKRPLN
Download sequence
Identical sequences A0A097CRW5 F4F9R9
WP_013734497.1.26845 WP_013734497.1.63642 gi|330468702|ref|YP_004406445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]