SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013774195.1.63594 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013774195.1.63594
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000183
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 
Weak hits

Sequence:  WP_013774195.1.63594
Domain Number - Region: 49-112
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0853
Family PB1 domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013774195.1.63594
Sequence length 127
Comment ABC transporter [Melissococcus plutonius]; AA=GCF_001047515.1; RF=na; TAX=33970; STAX=33970; NAME=Melissococcus plutonius; strain=119; AL=Contig; RT=Major
Sequence
MIEKINREFGTTIFITSHDLSDIEKVAKRIIIINKGELYYDGSIENLLSTSGKTHEILIE
IKSDSNLILESNYNIEMIDETNYKVTLQSKEDFVNVIKQIVKKNEIVNLKINEATLENVL
IELYNTF
Download sequence
Identical sequences F3YB81
WP_013774195.1.63594 WP_013774195.1.82989 WP_013774195.1.97133 gi|332686794|ref|YP_004456568.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]