SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013775538.1.74519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013775538.1.74519
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.35e-29
Family Pseudouridine synthase II TruB 0.0000444
Further Details:      
 
Domain Number 2 Region: 138-215
Classification Level Classification E-value
Superfamily PUA domain-like 8.84e-16
Family PUA domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013775538.1.74519
Sequence length 221
Comment tRNA pseudouridine(55) synthase TruB [Acidianus hospitalis]; AA=GCF_000213215.1; RF=representative genome; TAX=933801; STAX=563177; NAME=Acidianus hospitalis W1; strain=W1; AL=Complete Genome; RT=Major
Sequence
METHEKVDLPIVKKIAEEFKGTIYQRPPVRSSVKRRLRTRKVFDIEVLEGKDDKLFLLKI
SSEPGTYMRKICHDMGIILGTGAHMRELRRIRSGIFTENGLVTLQEVSEALYMWKNCKDE
TDLRKILLPMEIGLCGIPKIILDDNAVNAIAYGATANAPGIVAYQNFKKGDLVGLITLKG
EGVAIGKALVDSNSVQQMKKGEVIKPNRILIKRDVYPRAWK
Download sequence
Identical sequences F4B7L7
gi|332796420|ref|YP_004457920.1| WP_013775538.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]