SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013826778.1.26247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013826778.1.26247
Domain Number 1 Region: 85-175
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 3.01e-25
Family eIF2alpha middle domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 177-254
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 2.62e-20
Family eIF-2-alpha, C-terminal domain 0.0036
Further Details:      
 
Domain Number 3 Region: 7-88
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.58e-19
Family Cold shock DNA-binding domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013826778.1.26247
Sequence length 259
Comment translation initiation factor IF-2 subunit alpha [Methanobacterium paludis]; AA=GCF_000214725.1; RF=representative genome; TAX=868131; STAX=868131; NAME=Methanobacterium paludis; strain=SWAN1; AL=Complete Genome; RT=Major
Sequence
MVRMRKQWPDEGDLVVGTVHKVLNYGAFASLEEYDDKEAFIHISEVSSGWVKNIRDYVRE
NQKIVARVLRVNPQKGHVDVSLKRIREDQRTRKIQQWKIEQKAERLLEFAAKKLGKDLET
AYEEVGYGLMDEFGDLYGVFEISAEEGVESLKESKLSEEWAVAITEVAKRNISPPEVHIT
GYVNLHSYAPDGVEVIKRALGAIDKEGISVQCVGAPRYRLMVKSSDYITAETLLKEAAQQ
AIDVVEEEGGEGNFQRELE
Download sequence
Identical sequences F6D500
gi|333988473|ref|YP_004521080.1| WP_013826778.1.26247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]