SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013931024.1.37789 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013931024.1.37789
Domain Number 1 Region: 29-79
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000724
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013931024.1.37789
Sequence length 84
Comment proteinase inhibitor I4 serpin [Runella slithyformis]; AA=GCF_000218895.1; RF=representative genome; TAX=761193; STAX=106; NAME=Runella slithyformis DSM 19594; strain=DSM 19594; AL=Complete Genome; RT=Major
Sequence
MKMRSFYTALSWTATIVCLLSCEGSCPVPPNCSLEPESGVCFAAFKRYYYDKREKKCKEF
TWGGCGGVVPFETLEACRDCECRR
Download sequence
Identical sequences F8EQK6
WP_013931024.1.37789 gi|338214825|ref|YP_004658888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]