SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014162147.1.41951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014162147.1.41951
Domain Number - Region: 20-46
Classification Level Classification E-value
Superfamily BRK domain-like 0.0131
Family BRK domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014162147.1.41951
Sequence length 248
Comment regulatory protein [Pseudoxanthomonas spadix]; AA=GCF_000233915.3; RF=representative genome; TAX=1045855; STAX=415229; NAME=Pseudoxanthomonas spadix BD-a59; strain=BD-a59; AL=Complete Genome; RT=Major
Sequence
MIRLAPSEADLHAYVDGQLEAPARAEIERWLAAHPERAAVVADWKRDAKRLRVSQALPEQ
WPANPNLEPAHLRRRVRARGRARLGVAAALLLSLGLGTVTGWQARQLQVASARLPMADAV
SAYRLFAVSDRPDTLDAAARAQLQDWLGQHFGALGAMPDLHAQGLHLVGGQRLSTEQGAA
AMLVYADASGARIGVYLRPGGRFGQPGQRRDGELLAQYWSRGNTSFAVVSPFEDARARNV
AAVLAPGG
Download sequence
Identical sequences G7USW5
gi|357415847|ref|YP_004928867.1| WP_014162147.1.41951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]