SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014274263.1.3704 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014274263.1.3704
Domain Number - Region: 23-56
Classification Level Classification E-value
Superfamily Major surface antigen p30, SAG1 0.0366
Family Major surface antigen p30, SAG1 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014274263.1.3704
Sequence length 101
Comment hypothetical protein [Arthrospira platensis]; AA=GCF_000175415.3; RF=na; TAX=634502; STAX=118562; NAME=Arthrospira platensis str. Paraca; strain=Paraca; AL=Contig; RT=Major
Sequence
MRTDLVLKPEIIDGKTAYFIKIKNSAWIVETQVTLDEKDGVTIPCRADFIMRPASSRVES
LPVVVFTDGWEYHRDRIKEDFQQRQAIVRSGRFWCWSLRDD
Download sequence
Identical sequences D4ZZC3
gi|479127025|ref|YP_005066985.1| WP_014274263.1.32502 WP_014274263.1.3704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]