SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014305407.1.27978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014305407.1.27978
Domain Number - Region: 176-212
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.00262
Family P-domain of calnexin/calreticulin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014305407.1.27978
Sequence length 264
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_002005345.1; RF=na; TAX=492670; STAX=492670; NAME=Bacillus velezensis; strain=GH1-13; AL=Complete Genome; RT=Major
Sequence
MRQQEVHQFLLRFFEANHCPITEHGPGFMTVQLTVEMDKQIMNRPFYWHWREKTGGEPNP
MKITFITDKETAPEDMDGEFIYFGAPRLFQIFQAVKQNGRFTRIYEKIVSAGARVPLQPW
LGLNVVISYQSDMKKDRLLSLGLHLVSGTIIEGFQQKLAPLPLTSQISDYCFTISPMIKP
ESGIKRMEHYLKDAAAKEPSDWADSAIARWKKDLRLLDQFYEQTEEKPEEYHLEKQALKA
LYQPKIHIQIENGGLFFLQSNFSG
Download sequence
Identical sequences A0A1D9PLB5
gi|451346331|ref|YP_007444962.1| gi|375362994|ref|YP_005131033.1| WP_014305407.1.101182 WP_014305407.1.21864 WP_014305407.1.23363 WP_014305407.1.24336 WP_014305407.1.26408 WP_014305407.1.27978 WP_014305407.1.3071 WP_014305407.1.34883 WP_014305407.1.35817 WP_014305407.1.36989 WP_014305407.1.48909 WP_014305407.1.49114 WP_014305407.1.55276 WP_014305407.1.5788 WP_014305407.1.61124 WP_014305407.1.62871 WP_014305407.1.72986 WP_014305407.1.75310 WP_014305407.1.77593 WP_014305407.1.93153 WP_014305407.1.96909 WP_014305407.1.97374 WP_014305407.1.97917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]