SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014569500.1.70401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014569500.1.70401
Domain Number - Region: 56-83
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0248
Family Trimerization domain of TRAF 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014569500.1.70401
Sequence length 97
Comment MULTISPECIES: hypothetical protein [Lactobacillus]; AA=GCF_001656715.1; RF=na; TAX=47715; STAX=47715; NAME=Lactobacillus rhamnosus; strain=Lrh15; AL=Contig; RT=Major
Sequence
MTFFGYTIGDWAEVISIIGVGVSAGSWLFKKIALDPLRSDIQVLSETINRQLKLHEQSLA
DLGQHLRTHDDELGSHSVRITRLEDHVGIKGEDNHED
Download sequence
Identical sequences A0A1Y0DU03
gi|258539080|ref|YP_003173579.1| WP_014569500.1.100 WP_014569500.1.100405 WP_014569500.1.101629 WP_014569500.1.14484 WP_014569500.1.15430 WP_014569500.1.18871 WP_014569500.1.23805 WP_014569500.1.27841 WP_014569500.1.3013 WP_014569500.1.32471 WP_014569500.1.33665 WP_014569500.1.36475 WP_014569500.1.44898 WP_014569500.1.57253 WP_014569500.1.59185 WP_014569500.1.62246 WP_014569500.1.62275 WP_014569500.1.62506 WP_014569500.1.63053 WP_014569500.1.67395 WP_014569500.1.70398 WP_014569500.1.70401 WP_014569500.1.73229 WP_014569500.1.7391 WP_014569500.1.8089 WP_014569500.1.8195 WP_014569500.1.85765 WP_014569500.1.85933 WP_014569500.1.87473 WP_014569500.1.87509 WP_014569500.1.93242 WP_014569500.1.95170 WP_014569500.1.9713 WP_014569500.1.98686 568704.LC705_00889 gi|523519322|ref|YP_008205402.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]