SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014602950.1.3943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014602950.1.3943
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.71e-61
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 4.71e-44
Family PA2201 C-terminal domain-like 0.000000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014602950.1.3943
Sequence length 294
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_001990295.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=SCH_ABX10; AL=Contig; RT=Major
Sequence
MHAFPLTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYSFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences WP_014602950.1.13622 WP_014602950.1.13758 WP_014602950.1.25109 WP_014602950.1.2941 WP_014602950.1.29481 WP_014602950.1.32596 WP_014602950.1.33774 WP_014602950.1.37366 WP_014602950.1.39345 WP_014602950.1.3943 WP_014602950.1.46885 WP_014602950.1.51183 WP_014602950.1.51267 WP_014602950.1.65095 WP_014602950.1.76399 WP_014602950.1.85028 WP_014602950.1.88517 WP_014602950.1.94031 WP_014602950.1.94434 gi|386058897|ref|YP_005975419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]