SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014639588.1.28568 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014639588.1.28568
Domain Number - Region: 83-136
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0228
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014639588.1.28568
Sequence length 140
Comment hypothetical protein [Escherichia coli]; AA=GCF_000782655.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=blood-08-0997; AL=Scaffold; RT=Major
Sequence
MNQLPRRALSRYGLTFQGNILSVNCQCRMLTRVRRTHSTSPVENSLITNPQEGEMSTEND
EIINSLIRQINNFDKALQHAAARSDITLLAISFLASVMDKNEVVRQSLVDYIDSLQPGTF
NHEKEHVKSVINSLILNQKN
Download sequence
Identical sequences WP_014639588.1.100306 WP_014639588.1.28568 WP_014639588.1.67029 WP_014639588.1.67590 WP_014639588.1.77643 WP_014639588.1.90960 gi|386638434|ref|YP_006105232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]