SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014746297.1.78709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014746297.1.78709
Domain Number - Region: 33-82
Classification Level Classification E-value
Superfamily HR1 repeat 0.00785
Family HR1 repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014746297.1.78709
Sequence length 160
Comment F0F1 ATP synthase subunit B [Tistrella mobilis]; AA=GCF_000264455.2; RF=representative genome; TAX=1110502; STAX=171437; NAME=Tistrella mobilis KA081020-065; strain=KA081020-065; AL=Complete Genome; RT=Major
Sequence
MFSDPTFWVAVAFVLCIAGLGFLKVHKAIGGMLDARAAAIRAELDAAQKLREDAQALLAQ
YQRKQREAMQEAEQMVAHARTEAKRIVEMGQTQLAQSIERRERMAATKIAQAEADAIAEV
RATAVDVAMAATEQVLRTQLSADRQAKLVDDTIAGLKTLH
Download sequence
Identical sequences A0A162L7I6 I3TPD2
gi|389878639|ref|YP_006372204.1| WP_014746297.1.51402 WP_014746297.1.78709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]