SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014939684.1.95301 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014939684.1.95301
Domain Number 1 Region: 179-300
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000245
Family Matrix metalloproteases, catalytic domain 0.047
Further Details:      
 
Weak hits

Sequence:  WP_014939684.1.95301
Domain Number - Region: 64-102
Classification Level Classification E-value
Superfamily SRP19 0.0569
Family SRP19 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014939684.1.95301
Sequence length 343
Comment peptidase M10 [Lactobacillus buchneri]; AA=GCF_000298115.2; RF=representative genome; TAX=1071400; STAX=1581; NAME=Lactobacillus buchneri CD034; strain=CD034; AL=Complete Genome; RT=Major
Sequence
MNRVVKKLTLLAVGLLSFALMIDVAATSADAKTTAAKVVRVTPQKSTAYRAVKGIIYGDK
TLTQKLHNAKNYPETIFYATKRVTVRKPNGKTAVYYYVANKSKTITGYIWHGYLTKTQVA
MSQKSLMKLINAAPDMNPDETILSLKPVNYETHEAVFDLAYNVFHFSPTSMFKDHQALIY
VANPELNQHVQNAMNKWNTALGETVFQMGSQSHYTLKISFGSGTKEGWDGLYDGRQIYID
KAHYHDAKYPLGYIKPSLAAKFTIDQYWDGVLAHELGHTLGLDHTGYQADLMYAATSAGN
MIAKYAWQKPVEKSINGLDGTEMATITNRDLNRAKLTKLLGYW
Download sequence
Identical sequences J9W4J1
WP_014939684.1.95301 gi|406026645|ref|YP_006725477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]