SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015025883.1.21361 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015025883.1.21361
Domain Number 1 Region: 292-447
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-34
Family Histidine kinase 0.0017
Further Details:      
 
Weak hits

Sequence:  WP_015025883.1.21361
Domain Number - Region: 51-153
Classification Level Classification E-value
Superfamily eEF1-gamma domain 0.00484
Family eEF1-gamma domain 0.013
Further Details:      
 
Domain Number - Region: 221-289
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00824
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015025883.1.21361
Sequence length 447
Comment ATP-binding protein [Psychroflexus torquis]; AA=GCF_000153485.2; RF=representative genome; TAX=313595; STAX=57029; NAME=Psychroflexus torquis ATCC 700755; strain=ATCC 700755; AL=Complete Genome; RT=Major
Sequence
MNYNAYILKLFFRILLLVCTILAFGYSIYIDKTAYSILISIGLFYLIINTYTFVKRRFLA
MDDFFEAVKYRDFSRWFPEDRGPKDIRFLYTGFNEINRTIKEINSQNQAQYVYLQKILEM
VDIGIIAYNLESGDVLWSNDSFGEILDMPSFKNIRFVENRKPELFTTIFETYHREPDSLS
IALQNDNIKILISDTVFQVEADAFKLIVIQNIDDTLNKNESESWKKLLSVMTHEIMNSIT
PISSLADTLQMNLKVAIEKPKESHLELDDLSAGIKTIKNRSEGLLKFAKTYRSLSKVTHL
NLQRTRVSELFNNIQLLMQPSLEAKHIGIEFKITSSKLELDIDAHLIEQVLINLILNAVD
ACKNKDDAKIKVFASQNTNRAIVLKVIDNGSGIPKDILENIFIPFFTSKATGSGIGLSLC
KQIMLLHKGRIIVKSIEGEGSVFSLVF
Download sequence
Identical sequences K4IKL0
gi|408492724|ref|YP_006869093.1| WP_015025883.1.21361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]